Protein Info for CSW01_13600 in Vibrio cholerae E7946 ATCC 55056

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00081: Sod_Fe_N" amino acids 20 to 102 (83 residues), 88.9 bits, see alignment E=2.6e-29 PF02777: Sod_Fe_C" amino acids 109 to 212 (104 residues), 139.9 bits, see alignment E=2.7e-45

Best Hits

Swiss-Prot: 53% identical to SODM_GEOSE: Superoxide dismutase [Mn] (sodA) from Geobacillus stearothermophilus

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to vch:VC2694)

MetaCyc: 46% identical to superoxide dismutase (Mn) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Manganese superoxide dismutase (EC 1.15.1.1)" in subsystem Nitric oxide synthase or Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>CSW01_13600 superoxide dismutase (Vibrio cholerae E7946 ATCC 55056)
MLSALLIAKRYSSKEDTMPHLFPDLPYAYDALEPYIDTKTMEVHYSKHHRTYYDKFLSAI
KGTEHEDRPLSEIFARVSTLPAAVRNHGGGYYNHIVYWNCMKPNAGGEPQGELAAEIERQ
FGSFAQFKEAFSQAAVNTFGSGFVWLIVQQGQLSITSTSNQDNPLMDVVAVRGEPILALD
VWEHAYYIRYQNRRPEYIDAWWNVVNWEAVSENYAIALTQAA