Protein Info for CSW01_13595 in Vibrio cholerae E7946 ATCC 55056

Annotation: two-component system sensor histidine kinase CpxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details PF16527: CpxA_peri" amino acids 38 to 171 (134 residues), 210.2 bits, see alignment E=3.4e-66 PF00672: HAMP" amino acids 190 to 242 (53 residues), 40.5 bits, see alignment 7.1e-14 PF00512: HisKA" amino acids 248 to 307 (60 residues), 46.4 bits, see alignment E=8.6e-16 PF02518: HATPase_c" amino acids 355 to 462 (108 residues), 81 bits, see alignment E=2.1e-26

Best Hits

KEGG orthology group: K07640, two-component system, OmpR family, sensor histidine kinase CpxA [EC: 2.7.13.3] (inferred from 100% identity to vcj:VCD_001675)

Predicted SEED Role

"Copper sensory histidine kinase CpxA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>CSW01_13595 two-component system sensor histidine kinase CpxA (Vibrio cholerae E7946 ATCC 55056)
MRLPLPKLNNLYGRIFAIFWFTMLLVLFAVLTLPHLDPRKSRDLSPETHQRLLESRDRFE
QQFRNQSDLRAILFQLEGPDSQHRKHDGQPRFFITDLESNIITNSKQTDFRFKAMQNFCS
SIESVQKPQQRLYGRYMLAGPVPITLAKQDLLLYVGMRWDEPPPFLLRLFDKPFQLLLAI
MLVSTPLLLWLAWALSKPAQNLAQAAQRVARGEFVHDPKLERGTAEFQQAGRSFNQMVDA
VNQMVSGQQRLLSDISHELRSPLTRLRMANALAMRKLGSSSELERIDTEAQRLEQMIGDL
LALSRMQINSHLMREVQPLSSLWEELLKDAQFEAEQMHKMLTFDAIPERTINGTPKLLMS
ALENVVRNAIHYGQQQIHVAFTIQDQQLIVSVDDDGEGVPEEELADIFRPFYRVSTARDR
HSGGTGLGLAITENAIRQHSGTISANRSHLGGLQVRFTLPLASA