Protein Info for CSW01_13530 in Vibrio cholerae E7946 ATCC 55056

Annotation: primosomal protein N'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 734 PF17764: PriA_3primeBD" amino acids 7 to 102 (96 residues), 95 bits, see alignment E=5.9e-31 PF04851: ResIII" amino acids 199 to 360 (162 residues), 53.9 bits, see alignment E=6.2e-18 PF00270: DEAD" amino acids 204 to 366 (163 residues), 71.7 bits, see alignment E=2e-23 TIGR00595: primosomal protein N'" amino acids 222 to 730 (509 residues), 637.3 bits, see alignment E=8.9e-196 PF18319: Zn_ribbon_PriA" amino acids 446 to 472 (27 residues), 38.2 bits, see alignment (E = 3.3e-13) PF00271: Helicase_C" amino acids 503 to 589 (87 residues), 34.4 bits, see alignment E=6.9e-12 PF18074: PriA_C" amino acids 633 to 730 (98 residues), 86.7 bits, see alignment E=4.8e-28

Best Hits

Swiss-Prot: 57% identical to PRIA_ECOLI: Primosomal protein N' (priA) from Escherichia coli (strain K12)

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 100% identity to vcj:VCD_001689)

MetaCyc: 57% identical to primosomal protein N' (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (734 amino acids)

>CSW01_13530 primosomal protein N' (Vibrio cholerae E7946 ATCC 55056)
MRPSIARVCLPVPLDKSFDYLIPAHLFPVLGGRVQVPFGRQTLVGIVQSLTHQSDFPIEQ
LKSVQAVLDDAPVWPDKLQSLLHWCSQFYHYPLGETYANALPGALRKGKAAELTSHKEWR
LTALGQEQLMQGVKRGAVKQAQVLHLLQHGALSHQTLLDEEVSSTTLKALVEKGWIECEE
RKPVARPWPQELEAKVDKPRLNQEQAIAIAAVNSQQGFGCFLLEGVTGSGKTEVYLNLIT
PVLARGEQALVLVPEIGLTPQTINRFRQRFNVPVEVMHSALNDTERLNAWLAARDKVAGI
VIGTRSALLTPFAKLGIIIVDEEHDSSYKQQDSLRYHARDVAVMRAHLENIPIVLGSATP
ALETLHNALSGKYHHLQLTQRAGNALPTRNHALDVKGLYLESGLSAPLIAEMRRHLSAGN
QVMLFLNRRGFSPALMCHECGWIAECQRCDAYYTYHQHSNEMRCHHCGSQRPVLHQCKGC
GSTQLVTVGVGTEQLEAQLHTLFPEYRSVRIDRDSTRRKGSLESALTAIRKGEYQILIGT
QMLAKGHHFPDVTLVALLDVDGSLYSSDFRASERLAQLFIQVAGRAGRASKPGEVVLQTH
HPEHSLLQALLHKDYHHFALTALEERKLAQLPPYSFLSLFRAEANHTAQVEDFLRQVRET
LRCNPWFDSECMVLGPTPAPLAKRAGKFRWQLLLQTPNRTLMQKILQSARPALQQLPLAS
KVRWSIDIDPQDLS