Protein Info for CSW01_13440 in Vibrio cholerae E7946 ATCC 55056

Annotation: fumarate reductase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 25 to 55 (31 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details PF02313: Fumarate_red_D" amino acids 16 to 127 (112 residues), 150.4 bits, see alignment E=1.2e-48

Best Hits

Swiss-Prot: 100% identical to FRDD_VIBCM: Fumarate reductase subunit D (frdD) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K00247, fumarate reductase subunit D (inferred from 100% identity to vcm:VCM66_2579)

MetaCyc: 52% identical to fumarate reductase membrane protein FrdD (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase subunit D" in subsystem Succinate dehydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>CSW01_13440 fumarate reductase subunit D (Vibrio cholerae E7946 ATCC 55056)
MFLLWCKELIVINTNPKRSDEPVWWSLFGAGGTWFAMITPITVLVLGILAPLGVIDAEAL
SYERVSSFATSIIGALFIIGTLALPMWHAMHRVHHGMHDLKFHTGVAGKIACYGFATIIS
ALAVVFIFMI