Protein Info for CSW01_13430 in Vibrio cholerae E7946 ATCC 55056

Annotation: succinate dehydrogenase/fumarate reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF13085: Fer2_3" amino acids 8 to 111 (104 residues), 116.6 bits, see alignment E=1.6e-37 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 11 to 229 (219 residues), 311 bits, see alignment E=2e-97 PF13237: Fer4_10" amino acids 145 to 216 (72 residues), 44.5 bits, see alignment E=3.7e-15 PF13183: Fer4_8" amino acids 147 to 219 (73 residues), 42.2 bits, see alignment E=2.9e-14 PF13534: Fer4_17" amino acids 149 to 220 (72 residues), 32.1 bits, see alignment E=4.3e-11 PF12838: Fer4_7" amino acids 149 to 218 (70 residues), 31 bits, see alignment E=8.6e-11

Best Hits

Swiss-Prot: 72% identical to FRDB_SHIFL: Fumarate reductase iron-sulfur subunit (frdB) from Shigella flexneri

KEGG orthology group: K00245, fumarate reductase iron-sulfur protein [EC: 1.3.99.1] (inferred from 100% identity to vch:VC2657)

MetaCyc: 72% identical to fumarate reductase iron-sulfur protein (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>CSW01_13430 succinate dehydrogenase/fumarate reductase iron-sulfur subunit (Vibrio cholerae E7946 ATCC 55056)
MSAQRIQKVDILRYDPANDAEPHMQRFEVPFDETMSVLDAIGYVKDHLDKDLSYRWSCRM
AICGSCGIMVNGVPKLACKSFLRDYPEGVKIEPLANFPIEKDLIVDMTPFIERLEAIKPY
IIGNDRKPEDGTNLQTPEQMARYKQFAGCINCGLCYAACPQFGLNPEFLGPAALTLAHRY
NLDSRDNGKAERMKLINGDNGAWGCTFVGYCSEVCPKHVDPAAAVNQGKVESSLDFVIAM
LNPDGSPKKVEA