Protein Info for CSW01_13190 in Vibrio cholerae E7946 ATCC 55056

Annotation: metal-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 TIGR02443: conserved hypothetical protein" amino acids 2 to 60 (59 residues), 110.7 bits, see alignment E=1.2e-36 PF09526: DUF2387" amino acids 4 to 58 (55 residues), 76.4 bits, see alignment E=7e-26

Best Hits

Swiss-Prot: 46% identical to YHEV_ECO57: Uncharacterized protein YheV (yheV) from Escherichia coli O157:H7

KEGG orthology group: K07070, (no description) (inferred from 100% identity to vch:VC2605)

Predicted SEED Role

"Putative cytoplasmic protein ,probably associated with Glutathione-regulated potassium-efflux" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (66 amino acids)

>CSW01_13190 metal-binding protein (Vibrio cholerae E7946 ATCC 55056)
MKQKKRFIAGANCPQCKTADTLQWWVENSIELVECVECGFHEQRKPKSVEQSEHANEQMI
GIFKPE