Protein Info for CSW01_13175 in Vibrio cholerae E7946 ATCC 55056

Annotation: adenylosuccinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 TIGR00184: adenylosuccinate synthase" amino acids 6 to 425 (420 residues), 645.7 bits, see alignment E=1.6e-198 PF00709: Adenylsucc_synt" amino acids 6 to 424 (419 residues), 627.6 bits, see alignment E=4.6e-193

Best Hits

Swiss-Prot: 100% identical to PURA_VIBCM: Adenylosuccinate synthetase (purA) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 100% identity to vco:VC0395_A2180)

MetaCyc: 76% identical to adenylosuccinate synthetase (Escherichia coli K-12 substr. MG1655)
Adenylosuccinate synthase. [EC: 6.3.4.4]

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>CSW01_13175 adenylosuccinate synthetase (Vibrio cholerae E7946 ATCC 55056)
MGNNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLVIDGQKTVLHLIPSGI
LRNNVKCIIGNGVVLSPEALIKEMSGLEDRGVPVRERLFISEACPLILPYHVALDQAREA
ARGKKAIGTTGRGIGPAYEDKVARRGLRVGDLFDMASFAEKLQEVMAFHNFQLEHFYKVE
PVSYEAVLEQAKGYAELLTSMVIDVTNELDAARKRGDKIMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVAAGSGFGPRHLGYILGIAKAYCTRVGAGPFPTELFDEVGDHLGTKGHEFGA
TTGRKRRCGWFDAVAMRRAIQINSVTGFCLTKLDVLDGLKEIKICTGYQMPDGSIAEVSP
MAADAFENVTPIFETMPGWSETTFGAKTLAELPQTALDYIKRIEELTGVPVDIISTGPDR
NETIIKVHPFSA