Protein Info for CSW01_13125 in Vibrio cholerae E7946 ATCC 55056

Annotation: 50S ribosomal protein L2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR01171: ribosomal protein uL2" amino acids 3 to 273 (271 residues), 434.2 bits, see alignment E=9.7e-135 PF00181: Ribosomal_L2_N" amino acids 32 to 118 (87 residues), 123.8 bits, see alignment E=2.3e-40 PF03947: Ribosomal_L2_C" amino acids 125 to 250 (126 residues), 188.3 bits, see alignment E=5.1e-60

Best Hits

Swiss-Prot: 100% identical to RL2_VIBCH: 50S ribosomal protein L2 (rplB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02886, large subunit ribosomal protein L2 (inferred from 100% identity to vco:VC0395_A2171)

MetaCyc: 84% identical to 50S ribosomal subunit protein L2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L2p (L8e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>CSW01_13125 50S ribosomal protein L2 (Vibrio cholerae E7946 ATCC 55056)
MAIVKCKPTSAGRRHVVKVVNADLHKGKPYAPLLEKNSKNGGRNNNGRITVRHIGGGHKQ
HYRLVDFKRTKDGIPAKVERLEYDPNRSANIALVLYADGERRYIIAPKGLQAGDVIQSGP
DAPIKAGNAMPMRNIPVGSTIHNVELTPGKGAQLARSAGAYAQLVARDGAYVTLRLRSGE
MRKVLSEGRATIGEVGNAEHMLRELGKAGAARWRGVRPTVRGVVMNPVDHPHGGGEGRTS
GGRHPVSPWGVPTKGYKTRSNKRTDKYIVRRRNK