Protein Info for CSW01_13045 in Vibrio cholerae E7946 ATCC 55056

Annotation: 50S ribosomal protein L15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01071: ribosomal protein uL15
  • amino acids 3 to 143 (141 residues), 164.7 bits, E=5.8e-53
• PF00828: Ribosomal_L27A
  • amino acids 85 to 143 (59 residues), 50.7 bits, E=1e-17

Best Hits

Swiss-Prot: 100% identical to RL15_VIBCM: 50S ribosomal protein L15 (rplO) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K02876, large subunit ribosomal protein L15 (inferred from 99% identity to vco:VC0395_A2155)

MetaCyc: 78% identical to 50S ribosomal subunit protein L15 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L15p (L27Ae)" in subsystem Ribosome LSU bacterial

Protein Sequence (144 amino acids)

>CSW01_13045 50S ribosomal protein L15 (Vibrio cholerae E7946 ATCC 55056)
MLLNTLSPAAGSKHAPKRLGRGVGSGLGKTGGRGHKGQKSRSGGKVRPGFEGGQMPLKQR
LPKFGFTSRKSFVSAEVRLSELAKVTGDVVDLNALKAANLVTKNIEFAKIVLSGEINKAV
TVKGLRVTKGAKAAIEAAGGKIEE