Protein Info for CSW01_13035 in Vibrio cholerae E7946 ATCC 55056
Annotation: 50S ribosomal protein L36
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL36_VIBCH: 50S ribosomal protein L36 (rpmJ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K02919, large subunit ribosomal protein L36 (inferred from 92% identity to swd:Swoo_4669)MetaCyc: 84% identical to 50S ribosomal subunit protein L36 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L36p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (37 amino acids)
>CSW01_13035 50S ribosomal protein L36 (Vibrio cholerae E7946 ATCC 55056) MKVRASVKKICRNCKVIKRNGVVRVICSEPKHKQRQG