Protein Info for CSW01_13015 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA-directed RNA polymerase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR02027: DNA-directed RNA polymerase, alpha subunit" amino acids 24 to 317 (294 residues), 372.2 bits, see alignment E=8.9e-116 PF01193: RNA_pol_L" amino acids 29 to 229 (201 residues), 87 bits, see alignment E=8.4e-29 PF01000: RNA_pol_A_bac" amino acids 59 to 179 (121 residues), 122.1 bits, see alignment E=2.3e-39 PF03118: RNA_pol_A_CTD" amino acids 245 to 309 (65 residues), 84.2 bits, see alignment E=6.3e-28

Best Hits

Swiss-Prot: 100% identical to RPOA_VIBCH: DNA-directed RNA polymerase subunit alpha (rpoA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03040, DNA-directed RNA polymerase subunit alpha [EC: 2.7.7.6] (inferred from 100% identity to vco:VC0395_A2149)

MetaCyc: 90% identical to RNA polymerase subunit alpha (Escherichia coli K-12 substr. MG1655)
DNA-directed RNA polymerase. [EC: 2.7.7.6]

Predicted SEED Role

"DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>CSW01_13015 DNA-directed RNA polymerase subunit alpha (Vibrio cholerae E7946 ATCC 55056)
MQGSVTEFLKPRLVDIEQISTTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IEGVLHEYSTKEGVQEDILEILLNLKGLAVRVAEGKDEVFITLNKSGSGPVVAGDITHDG
DVEIVNPEHVICHLTSDNAAIAMRIKVERGRGYVPASARIHTEEDERPIGRLLVDATFSP
VDKIAYSVEAARVEQRTDLDKLVIDMETNGTLEPEEAIRRAATILAEQLDAFVDLRDVRV
PEEKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKS
LTEIKDVLASRGLSLGMRLENWPPASIAED