Protein Info for CSW01_12960 in Vibrio cholerae E7946 ATCC 55056

Annotation: sulfate adenylyltransferase subunit CysD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR02039: sulfate adenylyltransferase, small subunit" amino acids 22 to 315 (294 residues), 536.1 bits, see alignment E=1.4e-165 PF01507: PAPS_reduct" amino acids 42 to 269 (228 residues), 197.6 bits, see alignment E=8.5e-63

Best Hits

Swiss-Prot: 100% identical to CYSD_VIBCH: Sulfate adenylyltransferase subunit 2 (cysD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 100% identity to vcj:VCD_001803)

MetaCyc: 82% identical to sulfate adenylyltransferase subunit 2 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>CSW01_12960 sulfate adenylyltransferase subunit CysD (Vibrio cholerae E7946 ATCC 55056)
MRRRQASEKEAGKMDQQRLTHLKQLEAESIHIIREVAAEFDNPVMMYSIGKDSSVMLHLT
RKAFYPGKIPFPLLHVDTDWKFRDMITFRDTTAKKYGFDLIVHKNPEGLAAGINPFDHGS
SKHTDIMKTQGLKQALNKYGFDAAFGGARRDEEKSRAKERVYSFRDKNHTWDPKNQRPEL
WRTYNGQINKGESIRVFPLSNWTELDIWQYIYLENIEIVPLYLADVRPVVQRDGMLIMVD
DDRMKLREGEQIEHKSVRFRTLGCYPLTGAIESQANTLTEIIEEMLVATSSERQGRAIDH
DQSGSMELKKRQGYF