Protein Info for CSW01_12960 in Vibrio cholerae E7946 ATCC 55056

Annotation: sulfate adenylyltransferase subunit CysD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02039: sulfate adenylyltransferase, small subunit
  • amino acids 22 to 315 (294 residues), 536.1 bits, E=1.4e-165
• PF01507: PAPS_reduct
  • amino acids 42 to 269 (228 residues), 197.6 bits, E=8.5e-63

Best Hits

Swiss-Prot: 100% identical to CYSD_VIBCH: Sulfate adenylyltransferase subunit 2 (cysD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 100% identity to vcj:VCD_001803)

MetaCyc: 82% identical to sulfate adenylyltransferase subunit 2 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• assimilatory sulfate reduction II (1/3 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (5/10 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (2/12 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Protein Sequence (315 amino acids)

>CSW01_12960 sulfate adenylyltransferase subunit CysD (Vibrio cholerae E7946 ATCC 55056)
MRRRQASEKEAGKMDQQRLTHLKQLEAESIHIIREVAAEFDNPVMMYSIGKDSSVMLHLT
RKAFYPGKIPFPLLHVDTDWKFRDMITFRDTTAKKYGFDLIVHKNPEGLAAGINPFDHGS
SKHTDIMKTQGLKQALNKYGFDAAFGGARRDEEKSRAKERVYSFRDKNHTWDPKNQRPEL
WRTYNGQINKGESIRVFPLSNWTELDIWQYIYLENIEIVPLYLADVRPVVQRDGMLIMVD
DDRMKLREGEQIEHKSVRFRTLGCYPLTGAIESQANTLTEIIEEMLVATSSERQGRAIDH
DQSGSMELKKRQGYF