Protein Info for CSW01_12930 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 34 to 184 (151 residues), 107.7 bits, E=8e-35

Best Hits

Swiss-Prot: 40% identical to YBBA_ECOLI: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Escherichia coli (strain K12)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to vco:VC0395_A2131)

Predicted SEED Role

"ABC transporter ATP-binding protein YvcR"

Protein Sequence (238 amino acids)

>CSW01_12930 ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MPAHRSDPTSSVIELNDVVFCWPGASSPTLDIAHLQIARGEHLFVKGPSGCGKSTLLSLL
TGINTATQGVVSLLGSDLSRLSASQRDRFRADHIGYIFQQFNLLPYLSVLDNVTLPCHFS
ALRKQQVDGPLSHKAQSLLERLHLPSALLNKPVTELSIGQQQRVAAARALMGEPQLIIAD
EPTSALDYDNREAFIALLREEAERVGSTLVFVSHDPTLEKLFERSVHLPTLNRAGGWQ