Protein Info for CSW01_12905 in Vibrio cholerae E7946 ATCC 55056

Annotation: outer membrane protein assembly factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF17243: POTRA_TamA_1" amino acids 35 to 105 (71 residues), 74 bits, see alignment E=1.3e-24 PF01103: Omp85" amino acids 285 to 579 (295 residues), 102.6 bits, see alignment E=5e-33

Best Hits

KEGG orthology group: K07278, outer membrane protein (inferred from 100% identity to vch:VC2548)

Predicted SEED Role

"Uncharacterized protein YtfM precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>CSW01_12905 outer membrane protein assembly factor (Vibrio cholerae E7946 ATCC 55056)
MSPLYNESKSSMRRKSLPALISLWLFSAVSYADVKLEITGISGAEKDNVEAYLSSIAAQD
YSTSLRFQSQLERSMTEALNALGYYHPSIDFTVSEDNQRLRAAVTLGEVTRLSEVDIVIR
GEAEGDRDFQRLIRRSGLRVDAPLNHSLYDNLKSGIRNLALQKGYFNGDFQASRLEVIPE
LNQARVILHFDSGIRYLFGATTVEGSQIDENRVMSLRPFKQGEPYLVSQVGEFNQNLSNT
DWFSSVFVEPDLSQLDEGRELPIKVTLAPQARNQLETGLGYSTDVGVRGSLKWKKPWVNS
QGHSFDSSFSLSIPEQTITAGYKIPLEDALNEYYRIQYGMKHLDKRDTESLESNLSLERH
WQLDGGWHRTVFIRYLLENYRQGLQDDNSQFLLPGMTYTRTRTRSNSGLLTWGDKQTITL
EYGDPALLSETRVLRLQTGSSWLRTYARNHRALVRVDGGANLVDEFDQLSPSLRFFAGGD
NNLRGYGYKSISPQDASGALTGAKYIATSSIEYQYRLTGNWWAAMFMDVGDAFNDNPEWK
KGVGTGIRWISPVGPIRLDFAWGLDAAPGDEFKIHFTLGPEL