Protein Info for CSW01_12840 in Vibrio cholerae E7946 ATCC 55056

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 290 to 309 (20 residues), see Phobius details amino acids 316 to 342 (27 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 390 to 416 (27 residues), see Phobius details amino acids 427 to 451 (25 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 12 to 453 (442 residues), 291.7 bits, see alignment E=4.8e-91 PF03448: MgtE_N" amino acids 36 to 137 (102 residues), 89.8 bits, see alignment E=2.3e-29 PF00571: CBS" amino acids 140 to 195 (56 residues), 23.1 bits, see alignment 1.2e-08 amino acids 203 to 258 (56 residues), 27 bits, see alignment 7.2e-10 PF01769: MgtE" amino acids 323 to 446 (124 residues), 109.2 bits, see alignment E=2.5e-35

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to vcm:VCM66_2455)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>CSW01_12840 magnesium transporter (Vibrio cholerae E7946 ATCC 55056)
MAEQIEFDQAHLTLQEITEALDNGRFVHVRRQLQDMEPEDIAHLLEASPRKAREVLWQLT
DPEDYGEILDELNEDVKDALVSKMAPEKLAEATEGMDIDDVAYVLRSLPDDVSREVLSQM
DAADRMRVETALSYPEDTAGGLMNTDVITIRADVDVDVVLRYLRMKGELPEATDALYVID
DESKLIGHLSLVTLLTTQPDVPVSEVMDDADEAIKVDMKDSDIANLFERRNWVSAPVVDE
NQHLVGRITIDDVVDIIREDAEHSMMSMAGMDDDEDTFAPVVKSARKRSIWLGANVLAAL
AAASVSNMFEATLEQMAAVAVLMTIVPSMGGVAGNQTVALVIRGLALGHIGDSNKRELLM
KEAAIGLLNGITWALIIGAIVVVWKGEWMLGGIISAAMMTNLIVAGIAGVSIPILLKKMN
IDPALAGGMALTTVTDVIGLSVFLGLATLLLAS