Protein Info for CSW01_12805 in Vibrio cholerae E7946 ATCC 55056

Annotation: lipopolysaccharide transport periplasmic protein LptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR03002: lipopolysaccharide transport periplasmic protein LptA" amino acids 35 to 175 (141 residues), 154.8 bits, see alignment E=6.5e-50 PF03968: LptD_N" amino acids 45 to 156 (112 residues), 108.3 bits, see alignment E=1.3e-35

Best Hits

Swiss-Prot: 47% identical to LPTA_ECO57: Lipopolysaccharide export system protein LptA (lptA) from Escherichia coli O157:H7

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 100% identity to vch:VC2527)

MetaCyc: 46% identical to LPS export ABC transporter substrate-binding protein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>CSW01_12805 lipopolysaccharide transport periplasmic protein LptA (Vibrio cholerae E7946 ATCC 55056)
MPIIRLNFITKYKVDMKRSHLSLIACLLASTQAYALSTDREQPVYIDSDSQQLDMKSNRV
TFLGDVKLKQGSININADKLIVIRNAENGKIEEIEGYGNVATFSQLTDEGKTLYGEAKEL
YYKVRDDELVMINKAMLSQDDSEIRGSKIRYKISLQKLIADSDGKGRVSTVLQPQAIQE