Protein Info for CSW01_12730 in Vibrio cholerae E7946 ATCC 55056

Annotation: aspartate carbamoyltransferase regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 TIGR00240: aspartate carbamoyltransferase, regulatory subunit" amino acids 5 to 150 (146 residues), 205.9 bits, see alignment E=1.3e-65 PF01948: PyrI" amino acids 7 to 97 (91 residues), 108.5 bits, see alignment E=1.5e-35 PF02748: PyrI_C" amino acids 102 to 149 (48 residues), 67.6 bits, see alignment E=6.9e-23

Best Hits

Swiss-Prot: 100% identical to PYRI_VIBCM: Aspartate carbamoyltransferase regulatory chain (pyrI) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K00610, aspartate carbamoyltransferase regulatory subunit (inferred from 99% identity to vco:VC0395_A2093)

MetaCyc: 65% identical to aspartate carbamoyltransferase, PyrI subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate carbamoyltransferase regulatory chain (PyrI)" in subsystem De Novo Pyrimidine Synthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>CSW01_12730 aspartate carbamoyltransferase regulatory subunit (Vibrio cholerae E7946 ATCC 55056)
MSKETKLQVEAIKNGTVIDHIPAKVGIKVLKLFDMHNSAQRVTIGLNLPSSALGSKDLLK
IENVFISEAQANKLALYAPHATVNQIENYEVVKKLALQLPERINNVFACPNSNCISHNEP
VESSFKLSEKNNDIRLKCKYCEKVFARDVVTEIEA