Protein Info for CSW01_12705 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNA polymerase-associated protein RapA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 969 PF18339: Tudor_1_RapA" amino acids 3 to 53 (51 residues), 83.4 bits, see alignment 3e-27 PF18337: Tudor_RapA" amino acids 55 to 118 (64 residues), 82 bits, see alignment 9.8e-27 PF04851: ResIII" amino acids 168 to 317 (150 residues), 47.3 bits, see alignment E=7.9e-16 PF00270: DEAD" amino acids 172 to 317 (146 residues), 27.1 bits, see alignment E=1.2e-09 PF00176: SNF2-rel_dom" amino acids 172 to 347 (176 residues), 64.7 bits, see alignment E=2.8e-21 PF00271: Helicase_C" amino acids 494 to 603 (110 residues), 66.9 bits, see alignment E=6.5e-22 PF12137: RapA_C" amino acids 607 to 966 (360 residues), 477.5 bits, see alignment E=9.1e-147

Best Hits

Swiss-Prot: 79% identical to RAPA_ALIFM: RNA polymerase-associated protein RapA (rapA) from Aliivibrio fischeri (strain MJ11)

KEGG orthology group: K03580, ATP-dependent helicase HepA [EC: 3.6.4.-] (inferred from 77% identity to vsa:VSAL_I0352)

Predicted SEED Role

"RNA polymerase associated protein RapA (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.-

Use Curated BLAST to search for 3.6.1.- or 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (969 amino acids)

>CSW01_12705 RNA polymerase-associated protein RapA (Vibrio cholerae E7946 ATCC 55056)
MSFALGQRWISDTESDLGLGTVVALDARTVTLMFAASEENRVYARSDAPVTRVIFNVGDV
VDSQQGWSLQVEQVVEDQGVYTYLGTRVDTEESGVALREIFLSNQIRFNKPQDKLFAGQI
DRMDNFVLRYRALTNQYQQHKSPMRGLCGMRAGLIPHQLYIAHEVGRRHAPRVLLADEVG
LGKTIEAGMIIHQQVLTGRAERILIVVPETLQHQWLVEMMRRFNLHFSIFDEERCVEAFS
EADNPFETQQYVLCSLDFLRKSRQRFEQALEAEWDLLVVDEAHHLEWHPEKPSREYQVIE
ALAEQTPGVLLLTATPEQLGRESHFARLRLLDADRFYDYEAFVKEEEQYAPVADAVTALF
SGEKLSDEAKNKITELLSEQDVEPLFKALESHASEDEIALARQELIDNLMDRHGTGRVLF
RNTRAAIKGFPVRNVHLLPLEIPSQYTTSMRVAGMLGGKLTPEARAMKMLYPEEIFQEFE
GEESSWWQFDSRVNWLLEKVKAKRSEKILVIASRASTALQLEQALREREGIRATVFHEGM
SIIERDKAAAYFAQEEGGAQVLICSEIGSEGRNFQFANQLVMFDLPFNPDLLEQRIGRLD
RIGQKRDIDVYVPYLTETSQAILARWFQEGLNAFAETCPTGRAVYDAFAERLIPILAAGG
GEELEVIIEESAKLNKTLKSQLEVGRDRLLEMHSNGGEKAQQIAEQIAKTDGDTNLVTFA
LSLFDAIGLHQEDRGENALVVTPAEHMMVPSYPGLPYEGATITFDRDTALSREDMHFISW
EHPMVQGGIDLLMSEGVGTCAVSLLKNKALPVGTILLELVYVVDAQAPKRSGISRFLPVS
PIRILMDARGNDLSSQVEFESFNRQLSPVNRHLASKLVSSVQHDVHRLITASETAVEPRV
SAIREQAQRDMQQSLNSELERLLALKAVNPNIRDEEIEVLDQQIKELTGYIAQAQYQLDS
LRLIVVAHN