Protein Info for CSW01_12600 in Vibrio cholerae E7946 ATCC 55056

Annotation: 3-isopropylmalate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00169: 3-isopropylmalate dehydrogenase" amino acids 7 to 355 (349 residues), 544 bits, see alignment E=6.9e-168 PF00180: Iso_dh" amino acids 7 to 356 (350 residues), 485 bits, see alignment E=7.4e-150

Best Hits

Swiss-Prot: 100% identical to LEU3_VIBCH: 3-isopropylmalate dehydrogenase (leuB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00052, 3-isopropylmalate dehydrogenase [EC: 1.1.1.85] (inferred from 100% identity to vcj:VCD_001865)

MetaCyc: 77% identical to 3-isopropylmalate dehydrogenase (Escherichia coli K-12 substr. MG1655)
3-isopropylmalate dehydrogenase. [EC: 1.1.1.85]

Predicted SEED Role

"3-isopropylmalate dehydrogenase (EC 1.1.1.85)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 1.1.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>CSW01_12600 3-isopropylmalate dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MTDRDYKIAVLPGDGIGPEVMAQAHKVLDAIEQKHGIRFSREEHDVGGIAIDNHGCPLPE
STLRACEEADAVLFGSVGGPKWEHLPPNEQPERGALLPLRKHFQLFCNLRPAQIHQGLEA
FSPLRADISARGFDIVVVRELTGGIYFGQPKGREGEGAHEKAFDTEVYHRFEIERIARIA
FESARLRRKKVCSIDKANVLQSSILWREVVSEIAKEYPDVSLSHMYIDNATMQLIKDPAQ
FDVMLCSNIFGDILSDECAMITGSMGMLPSASMNESKFGLYEPAGGSAPDIAGKNIANPV
AQILSAALMLRYSLGEEAAARDIENAVSQALAAGELTADLAGSKPALSTSAMGDKIASYI
LNS