Protein Info for CSW01_12485 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR02939: RNA polymerase sigma factor RpoE" amino acids 2 to 190 (189 residues), 334.9 bits, see alignment E=1.6e-104 PF07638: Sigma70_ECF" amino acids 10 to 185 (176 residues), 33.6 bits, see alignment E=7.4e-12 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 21 to 185 (165 residues), 111.2 bits, see alignment E=4e-36 PF04542: Sigma70_r2" amino acids 25 to 93 (69 residues), 69.4 bits, see alignment E=3.6e-23 PF08281: Sigma70_r4_2" amino acids 134 to 181 (48 residues), 64.7 bits, see alignment E=9.4e-22 PF04545: Sigma70_r4" amino acids 135 to 181 (47 residues), 39.2 bits, see alignment E=7.8e-14

Best Hits

Swiss-Prot: 74% identical to RPOE_ECOLI: ECF RNA polymerase sigma-E factor (rpoE) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to vch:VC2467)

MetaCyc: 74% identical to RNA polymerase sigma factor RpoE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>CSW01_12485 RNA polymerase sigma factor RpoE (Vibrio cholerae E7946 ATCC 55056)
MNEQLTDQVLIERVQNGDKQAFNLLVLRYQNKVCNLISRYVSNSGDVADVAQEAFIKAYR
AIPTFRGESAFYTWLYRIAVNTAKNHIVAQSRRPPASDVDAEEAEFYEGGDALKELSNPE
NITLSKELKKTVFDAIDALPDDLKTAMTLRELDGLSYEEIAEVMDCPVGTVRSRIFRARE
AVEKKIKPLL