Protein Info for CSW01_12445 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA repair protein RecO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF11967: RecO_N" amino acids 5 to 77 (73 residues), 80.1 bits, see alignment E=9.8e-27 TIGR00613: DNA repair protein RecO" amino acids 7 to 230 (224 residues), 143.7 bits, see alignment E=3.3e-46 PF02565: RecO_C" amino acids 86 to 226 (141 residues), 85.1 bits, see alignment E=4.5e-28

Best Hits

Swiss-Prot: 100% identical to RECO_VIBC3: DNA repair protein RecO (recO) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 100% identity to vcm:VCM66_2382)

MetaCyc: 68% identical to recombination mediator protein RecO (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>CSW01_12445 DNA repair protein RecO (Vibrio cholerae E7946 ATCC 55056)
MSDGLQRCFVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLK
WSGNGSMKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTE
LAQSTNPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDN
LTFLGNELIAISERRFTSKEQLQAAKRFTRLALKPYLGGKPLKSRELFRQTTLPRARSTE
E