Protein Info for CSW01_12400 in Vibrio cholerae E7946 ATCC 55056

Annotation: nucleoside triphosphate pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00444: MazG family protein
  • amino acids 11 to 260 (250 residues), 344.8 bits, E=1.6e-107
• PF03819: MazG
  • amino acids 28 to 101 (74 residues), 98.9 bits, E=1.6e-32
  • amino acids 170 to 229 (60 residues), 30.4 bits, E=3.8e-11

Best Hits

Swiss-Prot: 58% identical to MAZG_ECO57: Nucleoside triphosphate pyrophosphohydrolase (mazG) from Escherichia coli O157:H7

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 100% identity to vcj:VCD_001904)

MetaCyc: 58% identical to nucleoside triphosphate pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (7/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• dZTP biosynthesis (3/5 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Pyrimidine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8 or 3.6.1.9

Protein Sequence (271 amino acids)

>CSW01_12400 nucleoside triphosphate pyrophosphohydrolase (Vibrio cholerae E7946 ATCC 55056)
MSHPIEQLEQIMRRLRDPEQGCPWDKEQTFDTIAPYTIEETFEVVDAITQRDWPNLREEL
GDLLFQVIFYSQMAKEQGLFEFRDVVETVNEKLTRRHPHVFGDATFENDAQIHANWEAEK
AKEKAQAGKSEQSILDSVPRSLPALSRAYKIQKKCAQYGFDWDSLGPVVEKVHEEVEEVM
EEALQVDVDTQKVEEELGDLLFATVNLVRHLGHDPEMALSKANAKFVRRFQGVEDKARAK
NKPLHAFTLAELDGFWDEVKLEEKQAIKSFS