Protein Info for CSW01_12335 in Vibrio cholerae E7946 ATCC 55056

Annotation: outer membrane protein TolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 22 to 433 (412 residues), 361.7 bits, see alignment E=2.8e-112 PF02321: OEP" amino acids 29 to 208 (180 residues), 147.4 bits, see alignment E=2e-47 amino acids 233 to 420 (188 residues), 163.6 bits, see alignment E=2.2e-52

Best Hits

Swiss-Prot: 100% identical to TOLC_VIBCH: Outer membrane protein TolC (tolC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 100% identity to vco:VC0395_A2013)

MetaCyc: 100% identical to outer membrane channel TolC (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-502

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>CSW01_12335 outer membrane protein TolC (Vibrio cholerae E7946 ATCC 55056)
MKKLLPLFVSAALGTLSSAVWAENLAEIYNQAKENDPQLLSVAAQRDAAFEAVTSSRSAL
LPQINLTAGYNINRSDQAPRESDLLSAGINFSQELYQRSSWVSLDTAEKKARQADSQYAA
TQQGLILRVAKAYFEVLRAQDNLEFVRAEKAAVGRQLEQTKQRFEVGLSAITDVHDAQAQ
FDGVLADEVLAENSLTNSYEALREITGQEYSKLAVLDTKRFAASRTTESSEALIEKAQQQ
NLSLLAARISQDVARDNISLASSGHLPSLTLDGGYNYGNNSNDNAKNTSGEEYNDFKIGV
NLKVPLYTGGNTTSLTKQAEFAYVAASQDLEAAYRSVVKDVRAYNNNINASIGALRAYEQ
AVISAKSALEATEAGFDVGTRTIVDVLDATRRLYDANKNLSNARYDYILSVLQLRQAIGT
LSEQDVMDVNAGLKVAKK