Protein Info for CSW01_12195 in Vibrio cholerae E7946 ATCC 55056

Annotation: cell division protein FtsL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details PF04999: FtsL" amino acids 9 to 104 (96 residues), 123.9 bits, see alignment E=1.1e-40 TIGR02209: cell division protein FtsL" amino acids 21 to 104 (84 residues), 100.8 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 100% identical to FTSL_VIBCH: Cell division protein FtsL (ftsL) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03586, cell division protein FtsL (inferred from 100% identity to vco:VC0395_A1986)

Predicted SEED Role

"Cell division protein FtsL" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>CSW01_12195 cell division protein FtsL (Vibrio cholerae E7946 ATCC 55056)
MPRQSPPNLAKLIALDLLTVGRVPLLLLVLIFSCAMGVVFMTHHTRQAISAKDQAFMERE
RLDNEWRNLILEETALAEHSRVQQLARKDLEMKRPDSDKEVVINLK