Protein Info for CSW01_12170 in Vibrio cholerae E7946 ATCC 55056

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF21799: MurD-like_N" amino acids 13 to 101 (89 residues), 106.4 bits, see alignment E=1.1e-34 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 13 to 441 (429 residues), 490.8 bits, see alignment E=2.3e-151 PF08245: Mur_ligase_M" amino acids 117 to 286 (170 residues), 105.5 bits, see alignment E=5.4e-34 PF02875: Mur_ligase_C" amino acids 309 to 420 (112 residues), 40 bits, see alignment E=1e-13

Best Hits

Swiss-Prot: 100% identical to MURD_VIBCH: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to vcj:VCD_001950)

MetaCyc: 52% identical to UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase. [EC: 6.3.2.9]

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>CSW01_12170 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Vibrio cholerae E7946 ATCC 55056)
MSISMDRWQGIQHVVVVGLGITGLSVVNYLRKYHPSVTVQVIDTREAPPGQEQLSSDVAL
HRSGWNLEWLLNADLVVTNPGIALATPEIQQVLAAGIPVVGDIELFAWHVDTPVIAITGS
NGKSTVTDLSGVLANAAGVKAAVGGNIGVPALDLISPDVELYVLELSSFQLETTSSLKLK
AAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFPDHAAHLQVVTFGVE
QAAQFSLAQHQGREYLFARDEAVMACAELSLVGRHNVANVLTVLALLDSAGVNFRLALDA
LKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAALSGLKIEGQLYLLVGGVGKGADF
TPLAPVLATLPVQLCCFGVDGHQFMPLHPSARFYDSMESIIRSIRPQLKSGDMVLLSPAC
ASFDQFKNFMARGDIFAQLARQYA