Protein Info for CSW01_12135 in Vibrio cholerae E7946 ATCC 55056

Annotation: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR00325: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase" amino acids 2 to 298 (297 residues), 469.2 bits, see alignment E=2.7e-145 PF03331: LpxC" amino acids 4 to 276 (273 residues), 366.4 bits, see alignment E=4.8e-114

Best Hits

Swiss-Prot: 100% identical to LPXC_VIBCH: UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 100% identity to vch:VC2396)

MetaCyc: 100% identical to UDP-3-O-acyl-N-acetylglucosamine deacetylase (Vibrio cholerae O1 biovar El Tor str. N16961)
RXN-23222 [EC: 3.5.1.108]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)" (EC 3.5.1.108)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>CSW01_12135 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (Vibrio cholerae E7946 ATCC 55056)
MIRQRTLKEIVKTTGVGLHSGRKVTLTLRPAAANTGIIYRRTDVNPPVDFPADPASVRDT
MLCTALVNDQGVRISTVEHLNAALAGMGIDNAIIEVDAPEIPIMDGSASPFVYLLQQAGI
QTLNAPKRFIRIKKPVRIEDGDKWAEFVPFNGFRMDFEIEFNHPAIDGDDQRLVFDFSSQ
GFVKEISRARTFGFMRDIEYLQSQNLCLGGSFDCAIVLDDYRILNEEGLRFDNEFVTHKV
LDAIGDLYMAGHAIVGEFRAYKSGHGLNNQLLRAVLADQEAWEWATFEEEVGSPVAFAEP
NMVLA