Protein Info for CSW01_12115 in Vibrio cholerae E7946 ATCC 55056

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 1 to 265 (265 residues), 336.4 bits, E=7.1e-105
• PF01113: DapB_N
  • amino acids 2 to 125 (124 residues), 149.7 bits, E=4.3e-48
• PF05173: DapB_C
  • amino acids 128 to 264 (137 residues), 156 bits, E=4.4e-50

Best Hits

Swiss-Prot: 100% identical to DAPB_VIBCH: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 100% identity to vco:VC0395_A1970)

MetaCyc: 64% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Protein Sequence (269 amino acids)

>CSW01_12115 4-hydroxy-tetrahydrodipicolinate reductase (Vibrio cholerae E7946 ATCC 55056)
MVRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVD
NLEQAVEQFDVIIDFTAPASTLANLALCEQHGKKLVIGTTGFTDAQRQTIEQAAKKIPIV
MAPNYSVGVNLVFKLLEKAAKVMGDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMGN
QLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTFA
NGAVKAAIWLAEQPAGFYTMIDVLGLNDL