Protein Info for CSW01_12080 in Vibrio cholerae E7946 ATCC 55056

Annotation: recombinase RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF13476: AAA_23" amino acids 61 to 295 (235 residues), 54 bits, see alignment E=1.3e-17 PF13514: AAA_27" amino acids 63 to 134 (72 residues), 24.1 bits, see alignment E=9e-09 PF13555: AAA_29" amino acids 64 to 109 (46 residues), 30.2 bits, see alignment 1.1e-10 PF13175: AAA_15" amino acids 64 to 424 (361 residues), 54.4 bits, see alignment E=5.5e-18 PF00005: ABC_tran" amino acids 77 to 136 (60 residues), 32.4 bits, see alignment 4.7e-11 PF13304: AAA_21" amino acids 88 to 427 (340 residues), 90.9 bits, see alignment E=5.4e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_001965)

Predicted SEED Role

"Putative ATP binding protein SugR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>CSW01_12080 recombinase RecF (Vibrio cholerae E7946 ATCC 55056)
MNEPTRIPKYVKDKIRQAKQGDLYSSFTVSEYYYDGEVLERDIEQSELYLRNVSRIINNA
KIRLRNISLYDYKKFSKLKFTSSEKNTTIIIGNNGSGKSTILESISKCLQFLSDNIRIQN
NNNYKFQDSEINIHSISGQTIVRCILEIENDFSFSCSLTKNRENISRKVSSELEEFKALA
RMYQRSNELDNNTLSYPLLAYYPVERSVTLKRDDAVKYYERKKAKYSDKSEGLKNAFDGT
SNFNDFFSWYKEIDDIINEFKANDSITKEEIEYLLSKTDNKEKIGSLISQLLEKKNNYNN
NEDREFLIRQQKVIQESIKTFVSDIDQVKISRTPHLDMTVIKNGSEISIFNLSQGEKTLI
ALVSDIARRLVILNPSLENPLNGYGIVLIDEIDLHLHPKWQQTIVQKLENTFPNIQFILS
THSPLVLTTVTSEQIKIINELDYRFKLLSPTSNPFGKNASDALAIMETSESPLVHSEEIL
ALIKKYESLVKRGQEDCRKTKEIKKRIESTGYTFDIADIEMWRFIAENREFFIDKSESDD