Protein Info for CSW01_12060 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 82 (17 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 8 to 82 (75 residues), 85.6 bits, see alignment E=8.4e-29 amino acids 95 to 164 (70 residues), 72.1 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 100% identical to Y2382_VIBCH: UPF0126 membrane protein VC_2382 (VC_2382) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vch:VC2382)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>CSW01_12060 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MDTSLLYLIDMFGTAVFAVSGVLLAGRLKMDPFGVMVLASVTAIGGGTIRDMALGATPVF
WIKDTNYLWVIMITCALTMLLVRRPKRLAWWILPVCDAIGLAVFVGIGVEKALIYQDSAL
IAIIMGVITGCGGGIIRDVLAREIPMVLRSEVYATACIIGGIFHTTALAMGYSSSTALLS
GVFSTLLIRLGAIRWHLSLPTFALTK