Protein Info for CSW01_12050 in Vibrio cholerae E7946 ATCC 55056

Annotation: adenosylcobinamide-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 30 to 33 (4 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details PF03186: CobD_Cbib" amino acids 19 to 290 (272 residues), 126.3 bits, see alignment E=7.1e-41

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 100% identity to vch:VC2380)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>CSW01_12050 adenosylcobinamide-phosphate synthase (Vibrio cholerae E7946 ATCC 55056)
METGFSHFYANGALLVMWGALLFHLLLPIPHAAHPVTLWHKFAELLASKVNTPASYAQNL
LSGALAWGLMIFPTMALLWALKPLVWQPQLFDLALLLLSLDWRRQETLANQLAQALAKED
KPQARALLQPFVNRQTTTLSALGLGKAGVETLVMGFGRNVIGVLFWYGVLGGSGAFLYRL
IAELARAWSPSRTTFQPFGFTAVRILALLDWLPLRLFSLLIILGKQAGTIFKTVLEQSRS
WPLPGPAWLLCAVGNKLQLALGGPAIYGEQKSVRAKIGGRIAPAAIHIAQVQSLIAWRIF
VWIALESLLLLLIYRGV