Protein Info for CSW01_12025 in Vibrio cholerae E7946 ATCC 55056

Annotation: glutamate synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR01317: glutamate synthase, NADH/NADPH, small subunit" amino acids 3 to 478 (476 residues), 664.5 bits, see alignment E=5.2e-204 PF14691: Fer4_20" amino acids 34 to 131 (98 residues), 87.2 bits, see alignment E=2.6e-28 PF07992: Pyr_redox_2" amino acids 146 to 461 (316 residues), 93.1 bits, see alignment E=8.8e-30 PF01494: FAD_binding_3" amino acids 146 to 179 (34 residues), 23.5 bits, see alignment (E = 1.3e-08) PF00070: Pyr_redox" amino acids 147 to 179 (33 residues), 23.3 bits, see alignment (E = 3.1e-08) PF00890: FAD_binding_2" amino acids 147 to 182 (36 residues), 23.9 bits, see alignment 9.2e-09 PF13450: NAD_binding_8" amino acids 149 to 183 (35 residues), 36.3 bits, see alignment 2.2e-12 PF01593: Amino_oxidase" amino acids 155 to 183 (29 residues), 27.6 bits, see alignment (E = 7.6e-10)

Best Hits

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to vcm:VCM66_2297)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>CSW01_12025 glutamate synthase subunit beta (Vibrio cholerae E7946 ATCC 55056)
MGKATGFLEFGRELPKKIDPAERIKNNKEFVLNQEFGKKINQQASRCMDCGVPFCHNGCP
IGNIIPEFNDAVYRDSWEEAWNILSSTNNFPEFTGRVCPAPCETACVLGINQDPITICNI
EKTIVERAYQEGYAKPKTPRSRTGKTVAIIGSGPAGLAAAEQLNAAGHSVTVFERDEKVG
GLLRFGIPDFKLGMDVIDRKINLMEQAGVKFVVNAHIGVDINAQQLRQEFDAVLLTGGST
VPRDLSIPGRDLKGVYFAMQFLAQNNRRANGMDLKGEEIHAKGKHVVVIGGGDTGSDCVG
TSNRHGAASITQVEIMPIPPQKRPVNMPWPQYPMILRTSTSHEEGCERHWNILTKEFIGN
EQGEVTGLRIADIVWKDAAPGERPSFDEVVGSERVIPCDMAFLAMGFLHPEPHGVLAQLG
IKLDERGNVATQDFATNQKGVFAAGDMRTGQSLVVRCINEGRECARAVDTFLMGNTHLEA
KADSLMLSA