Protein Info for CSW01_12005 in Vibrio cholerae E7946 ATCC 55056

Annotation: aerobic respiration two-component sensor histidine kinase ArcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 785 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details PF18415: HKR_ArcB_TM" amino acids 15 to 89 (75 residues), 99 bits, see alignment E=7.4e-32 TIGR00229: PAS domain S-box protein" amino acids 152 to 276 (125 residues), 62.8 bits, see alignment E=1.7e-21 PF00989: PAS" amino acids 156 to 266 (111 residues), 60.3 bits, see alignment E=7.2e-20 PF08448: PAS_4" amino acids 162 to 271 (110 residues), 61 bits, see alignment E=5e-20 PF13426: PAS_9" amino acids 171 to 268 (98 residues), 34.3 bits, see alignment E=9.7e-12 PF00512: HisKA" amino acids 283 to 345 (63 residues), 61.7 bits, see alignment 2.3e-20 PF02518: HATPase_c" amino acids 395 to 508 (114 residues), 100.4 bits, see alignment E=3.3e-32 PF00072: Response_reg" amino acids 529 to 638 (110 residues), 64.4 bits, see alignment E=4.2e-21 PF01627: Hpt" amino acids 691 to 763 (73 residues), 49.9 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: K07648, two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC: 2.7.13.3] (inferred from 100% identity to vcm:VCM66_2292)

Predicted SEED Role

"Aerobic respiration control sensor protein arcB (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (785 amino acids)

>CSW01_12005 aerobic respiration two-component sensor histidine kinase ArcB (Vibrio cholerae E7946 ATCC 55056)
MKPMKNLAQYYVDLLVKLGILRFSILLALALVALAVVVQVGITLILNGFVDDIDIIRSVF
FGLLITPWAVYFLSVVVDQLEESRQRLSKLVSKLKDMRSRDQELNQKLQQNIVKLNQEIE
ERIKAEEAREEAMADLENEVYQREKTQVELAERTALLRSFIDASPDLIYYRNAKGEFSGC
NRAMEELTGKRESELVGLTPWDVYRKEIAQSIVETDQQVFNNNTAITYEQWLEYPDGRKS
FFELRKVPFYNKDGRHLGLVGFGRDITERKRHEESLEKASRDKTTFISTISHELRTPLNG
IVGLSRMLLDTPLSGEQRKHLQTINVSAVTLGNIFNDIIDMDKFDRRKLELFPAALNFEE
FVAEIEVLAALMAEQKGLRFDLERLTDLPSLVEVDSTRLRQVLWNLLSNAMKFTKEGGVV
MTVSAECDAQHAEITIEVEDTGIGIPEAEQEKIFAMYYQVKSGKDNLHAVGTGIGLAVSR
QLIKLMGGDISVNSEEGFGSTFTVTIRVPLLAEAPIEIEPQEPQTELNIFMVEDIELNIT
VARSLLESMGHKVTVAMTGEEAIQGFNPTEYDLVFLDIQLPDMTGFDIAHYYRTHYSSLP
PLVALTANVLKDKEEYRQKGMDAAISKPLSVAAVREVIAKMTQHHAGESVAKVKSNKEKE
LPDDLYQQLLDLEMLQSYVEIVGSQPVIDSVHLFEQSMPAYLAVLDSNMVAKDQEGIVSE
AHKIKGAAGSVGLKRIQKIAQKAQSPEAPAWWENISDWVEEIKNEYQSDIALLKRWLTQQ
ANAKQ