Protein Info for CSW01_11970 in Vibrio cholerae E7946 ATCC 55056

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00191: homoserine kinase
  • amino acids 3 to 314 (312 residues), 359 bits, E=7.9e-112
• PF00288: GHMP_kinases_N
  • amino acids 90 to 156 (67 residues), 54.6 bits, E=1.2e-18
• PF08544: GHMP_kinases_C
  • amino acids 217 to 293 (77 residues), 42.4 bits, E=7.8e-15

Best Hits

Swiss-Prot: 100% identical to KHSE_VIBCH: Homoserine kinase (thrB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 99% identity to vco:VC0395_A1942)

MetaCyc: 71% identical to homoserine kinase (Escherichia coli K-12 substr. MG1655)
Homoserine kinase. [EC: 2.7.1.39]; 2.7.1.- [EC: 2.7.1.39]

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Protein Sequence (318 amino acids)

>CSW01_11970 homoserine kinase (Vibrio cholerae E7946 ATCC 55056)
MSVVVYAPASIGNVSVGFDVLGAAVSPIDGTLLGDRVKVEAGAEAFTLKTAGRFVDKLPA
NPQENIVYDCWQVFARELEKKSVVLKPLTMTLEKNMPIGSGLGSSACSIVAALDALNQFH
ASPLDETELLALMGEMEGKISGSIHYDNVAPCYLGGVQLMLEELGIISQSVPSFDDWYWV
MAYPGIKVSTAEARAILPAQYRRQDIVAHGRYLAGFIHACHTQQPELAAKMIKDVIAEPY
REKLLPGFAKARNYAASAGALATGISGSGPTLFSVCKEQAVAERVARWLEQNYVQNEEGF
VHICRLDKQGSKVTGSEL