Protein Info for CSW01_11960 in Vibrio cholerae E7946 ATCC 55056

Annotation: autonomous glycyl radical cofactor GrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04365: autonomous glycyl radical cofactor GrcA
  • amino acids 2 to 125 (124 residues), 224.8 bits, E=1.4e-71
• PF01228: Gly_radical
  • amino acids 15 to 106 (92 residues), 72.7 bits, E=1.7e-24

Best Hits

Swiss-Prot: 100% identical to GRCA_VIBCH: Autonomous glycyl radical cofactor (grcA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06866, autonomous glycyl radical cofactor (inferred from 100% identity to vcm:VCM66_2284)

MetaCyc: 77% identical to stress-induced alternate pyruvate formate-lyase subunit (Escherichia coli K-12 substr. MG1655)
Formate C-acetyltransferase. [EC: 2.3.1.54]; 2.3.1.54 [EC: 2.3.1.54]

Predicted SEED Role

"Pyruvate formate-lyase (EC 2.3.1.54)" in subsystem Butanol Biosynthesis or Fermentations: Mixed acid (EC 2.3.1.54)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (20/22 steps found)
• mixed acid fermentation (15/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-threonine degradation I (6/6 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.54

Use Curated BLAST to search for 2.3.1.54

Protein Sequence (125 amino acids)

>CSW01_11960 autonomous glycyl radical cofactor GrcA (Vibrio cholerae E7946 ATCC 55056)
MIQGIQITKAANDDLLNSIWLLDSEKNEARCVAALKGFEADQVVSINDLGQFESREVAIE
AAPRIEGGQHLNVNVLKRETLEDAVAHPEKYPQLTIRVSGYAVRFNSLTAEQQRDVIART
FTESL