Protein Info for CSW01_11960 in Vibrio cholerae E7946 ATCC 55056

Annotation: autonomous glycyl radical cofactor GrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 TIGR04365: autonomous glycyl radical cofactor GrcA" amino acids 2 to 125 (124 residues), 224.8 bits, see alignment E=1.4e-71 PF01228: Gly_radical" amino acids 15 to 106 (92 residues), 74.8 bits, see alignment E=3.7e-25

Best Hits

Swiss-Prot: 100% identical to GRCA_VIBCH: Autonomous glycyl radical cofactor (grcA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06866, autonomous glycyl radical cofactor (inferred from 100% identity to vcm:VCM66_2284)

MetaCyc: 77% identical to stress-induced alternate pyruvate formate-lyase subunit (Escherichia coli K-12 substr. MG1655)
Formate C-acetyltransferase. [EC: 2.3.1.54]; 2.3.1.54 [EC: 2.3.1.54]

Predicted SEED Role

"Pyruvate formate-lyase (EC 2.3.1.54)" in subsystem Butanol Biosynthesis or Fermentations: Mixed acid (EC 2.3.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.54

Use Curated BLAST to search for 2.3.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>CSW01_11960 autonomous glycyl radical cofactor GrcA (Vibrio cholerae E7946 ATCC 55056)
MIQGIQITKAANDDLLNSIWLLDSEKNEARCVAALKGFEADQVVSINDLGQFESREVAIE
AAPRIEGGQHLNVNVLKRETLEDAVAHPEKYPQLTIRVSGYAVRFNSLTAEQQRDVIART
FTESL