Protein Info for CSW01_11950 in Vibrio cholerae E7946 ATCC 55056

Annotation: uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00628: uracil-DNA glycosylase
  • amino acids 6 to 213 (208 residues), 292.6 bits, E=1e-91
• PF03167: UDG
  • amino acids 53 to 211 (159 residues), 65.5 bits, E=2.9e-22

Best Hits

Swiss-Prot: 100% identical to UNG_VIBC3: Uracil-DNA glycosylase (ung) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 100% identity to vch:VC2359)

MetaCyc: 72% identical to uracil-DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2584 [EC: 3.2.2.27]

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.27

Protein Sequence (226 amino acids)

>CSW01_11950 uracil-DNA glycosylase (Vibrio cholerae E7946 ATCC 55056)
MSESLTWHDVIGNEKQQAYFQQTLQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVI
LGQDPYHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPPHGYLQSWAQQGVL
LLNTVLTVEQGMAHSHANTGWETFTDRVIDALNQHRNGLIFLLWGSHAQKKGQMIDRQRH
HVLMAPHPSPLSAHRGFLGCRHFSKTNQLLQAQGIAPINWQPELES