Protein Info for CSW01_11870 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 TIGR00416: DNA repair protein RadA" amino acids 1 to 452 (452 residues), 738.9 bits, see alignment E=1e-226 PF18073: Zn_ribbon_LapB" amino acids 8 to 35 (28 residues), 40 bits, see alignment (E = 8.5e-14) PF13481: AAA_25" amino acids 77 to 223 (147 residues), 50.6 bits, see alignment E=6.6e-17 PF06745: ATPase" amino acids 77 to 148 (72 residues), 35.2 bits, see alignment E=3.1e-12 PF13541: ChlI" amino acids 345 to 431 (87 residues), 36 bits, see alignment E=2.1e-12 PF05362: Lon_C" amino acids 353 to 450 (98 residues), 29.5 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 80% identical to RADA_ECOLI: DNA repair protein RadA (radA) from Escherichia coli (strain K12)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 100% identity to vcm:VCM66_2266)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>CSW01_11870 DNA repair protein RadA (Vibrio cholerae E7946 ATCC 55056)
MVKAKRAYVCNECGADFPRWQGQCNACGSWNSISEVRLAASPQVARNERLVGYAGALEAK
VQTLADIDLQEVPRFTSGFKELDRVLGGGIVPGAAILIGGNPGAGKSTLLLQTMCLLSGQ
MPTLYVTGEESLQQVAMRASRLGLPKQHLKMLSETNVDRICQIAEQEKPRIMVIDSIQVM
HVADVQSSPGSVAQVRESATALTRYAKQNNVAVFIVGHVTKDGTLAGPKVLEHIIDCSIL
LDGDTDSRFRTLRSHKNRFGAVNELGVFAMTGQGMREVSNPSAIFLSRGEEATSGSSVMV
VWEGTRPLLVEIQALVDYSQLANPRRVAVGLEQNRLSLLLAVLHKHGGLQMADQDVFVNV
VGGVKVTETSADLALLMALLSSFRDRPLPKDVVVFGEVGLAGEIRPVPSGQERLNEAFKH
GFKKAIVPIANMPKGGIEGMQIHGVKKLSDAIAAFDEL