Protein Info for CSW01_11755 in Vibrio cholerae E7946 ATCC 55056

Annotation: murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF03562: MltA" amino acids 112 to 253 (142 residues), 114.8 bits, see alignment E=4e-37 PF06725: 3D" amino acids 273 to 349 (77 residues), 71.2 bits, see alignment E=7e-24

Best Hits

Swiss-Prot: 100% identical to MLTA_VIBCH: Membrane-bound lytic murein transglycosylase A (mltA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K08304, membrane-bound lytic murein transglycosylase A [EC: 3.2.1.-] (inferred from 100% identity to vcm:VCM66_2235)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>CSW01_11755 murein transglycosylase (Vibrio cholerae E7946 ATCC 55056)
MSKRLLSLASLALLFGCAQQPNDRAQQYQQQTFPHILNRADVVESNKPRDYTEFSKQSEL
VVQGSASMAKIYRPLYEQLNEWVLQSGDPATLAQFGIQAAQLGGGDKQGNVLFTGYFSPV
IELRHQPDSVFKYPVYGLPKCNKNCPTRAEIYQGALDGQGLELGYAENLIDPFIMEVQGS
GFVHFGDDDTLEYFAYAGKNNKAYVSIGKVLIERGLVEREKMSLKAIKDWVLANDEATVR
ELLEENPSFVFFKPSAAAPVKGSAGIPLLPMASVAGDRSILPMGTPILAEVPLLNADGTW
SGAHQLRLLIVLDTGGAVKQNHLDLYHGMGPRAGLEAGHYKHFGRVWKLGLENSPTQAPW
ALPPEKQQ