Protein Info for CSW01_11705 in Vibrio cholerae E7946 ATCC 55056

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 351 to 377 (27 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 268 (243 residues), 46.6 bits, see alignment E=2.3e-16 PF13000: Acatn" amino acids 52 to 184 (133 residues), 24.2 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 100% identity to vcm:VCM66_2223)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>CSW01_11705 MFS transporter (Vibrio cholerae E7946 ATCC 55056)
MVQQPRSHSWLELIVSYFDRRLLWVFMLGCASGFPWVLIGSNMTGWLKDAGLSRAAIGYF
GSVFAVYAINFLWAPLVDRVKLPILHSMLGQRRSWIFFCQSIVLVCTLLIAGVNPANNLM
LTSMFALGIAIASATQDVAVDAFRIDTFPKSESTKLPQASAMAVVGWWTGYSLPGYFAFV
NADSIGWNGVYYIMAGVVGLLMLFTLLVGEPHTQRDQLQQLAEERHQQVVSNPVLSWLTV
TVLEPFIDFFRRNGFRVALTLLLFVFLFKIGEAFLGRMSIAFYKEIGFSNEQIGYYSKLL
GWGITILFTLLGSLVNIKFGIVRGLMIGGIAMASSNLMFAWIAKVGPNEHLFLATLFVDN
FTSAFSTVAFVSFLTLMTGQAFSATQYALLASLGNLGRTTIASFSGELADFLNDWSLFFI
LTAVMVIPSLIMLYSLRHDFTKMLENAKQHKEELPPEDKIIQ