Protein Info for CSW01_11595 in Vibrio cholerae E7946 ATCC 55056

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 234 to 260 (27 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 376 to 401 (26 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 17 to 390 (374 residues), 192.2 bits, see alignment E=6.3e-61

Best Hits

Swiss-Prot: 56% identical to Y326_METJA: Putative permease MJ0326 (MJ0326) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to vch:VC2278)

MetaCyc: 53% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>CSW01_11595 NCS2 family permease (Vibrio cholerae E7946 ATCC 55056)
MLEKLFKLSEYGTNVRTEILAGVTTFLTMAYIIFVNPAILSDAGMDRGAVFVATCLAAAI
GCFIMGFIANYPIAQAPGMGLNAFFTYGVVLGMGHTWQVALAAVFCSGVLFILLSLFKIR
EWIINSIPHSLRTGISAGIGLFLAFIALKNAGIVVDNPATLVSLGAITSLHAVLAAVGFF
LTIGLVYRGVKGAVMIAILAVTALGLVFGDVQWGGIMSTPPSIAPTFMQLDFSAVFEIGM
ISVVFAFLFVDLFDTAGTLVGVATKAGLIEKDGKIPRLNRALLADSTATSVGALLGTSNT
TSYIESVSGVAVGGRTGLTAVVVGILFLLALFFSPLAGMIPAYATAGALFYVAILMMSGL
VSIDWRDLTEAAPTVVTCLMMPLTFSIAEGISLGFIAYAAIKLFSGKGRSVSLSVWVMAA
IFVIKYILAA