Protein Info for CSW01_11540 in Vibrio cholerae E7946 ATCC 55056

Annotation: N utilization substance protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR01951: transcription antitermination factor NusB" amino acids 10 to 150 (141 residues), 141.7 bits, see alignment E=8e-46 PF01029: NusB" amino acids 11 to 149 (139 residues), 121.3 bits, see alignment E=2e-39

Best Hits

Swiss-Prot: 100% identical to NUSB_VIBCH: Transcription antitermination protein NusB (nusB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 100% identity to vco:VC0395_A1857)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>CSW01_11540 N utilization substance protein B (Vibrio cholerae E7946 ATCC 55056)
MGASVKPAARRNARQFALQAIYSWQITKENVATIEEQFLTSGKYDEEEHRAAEPALAAPE
TDVSYFRDLLAGVVLNHNELDSKLRPFVSRPMQDLDMMELALLRLAMYEMTRREDVPYKV
VINEAIELAKVFAAEDSHKFVNGVLDKAAPHVRKKA