Protein Info for CSW01_11515 in Vibrio cholerae E7946 ATCC 55056

Annotation: type I methionyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00500: methionine aminopeptidase, type I
  • amino acids 3 to 267 (265 residues), 299.1 bits, E=1.3e-93
• PF00557: Peptidase_M24
  • amino acids 12 to 259 (248 residues), 175.3 bits, E=7.3e-56

Best Hits

Swiss-Prot: 50% identical to MAP1_RICPR: Methionine aminopeptidase (map) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to vcj:VCD_002080)

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

• Arg/N-end rule pathway (eukaryotic) (8/14 steps found)
• Ac/N-end rule pathway (6/21 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.18

Protein Sequence (280 amino acids)

>CSW01_11515 type I methionyl aminopeptidase (Vibrio cholerae E7946 ATCC 55056)
MSIKIKNAVEIEKMRVAGRLAAEVLEMIEPHVKAGVTTEELDQICHKYITEVQGAIPAPL
NYHGFPKSICTSINHIVCHGIPASEDTYFGQIQRPAVLRDGDILNIDITVIKDGYHGDTS
KMFLIGDVSIEDKRLCHVAQECLYLALKQVKPGVQLGEIGTTIEKHIKTNNKNNPRFKFS
IVRDYCGHGIGAEFHEEPQVVHYKNSDRTVLREGMIFTIEPMINAGKFGCRLDDEDSWTV
YTADGKKSAQWEHTILVTATGCEILTLRSEESLPRILNNA