Protein Info for CSW01_11460 in Vibrio cholerae E7946 ATCC 55056

Annotation: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD
  • amino acids 8 to 329 (322 residues), 400 bits, E=3.4e-124
• PF04613: LpxD
  • amino acids 24 to 88 (65 residues), 72.8 bits, E=2.4e-24
• PF00132: Hexapep
  • amino acids 109 to 144 (36 residues), 39.6 bits, 4.2e-14
  • amino acids 146 to 179 (34 residues), 37.3 bits, 2.1e-13
• PF14602: Hexapep_2
  • amino acids 112 to 143 (32 residues), 35.3 bits, see alignment (E = 1.1e-12)
  • amino acids 147 to 180 (34 residues), 14.3 bits, 4.3e-06

Best Hits

Swiss-Prot: 100% identical to LPXD_VIBCH: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to vco:VC0395_A1841)

MetaCyc: 100% identical to UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Vibrio cholerae O1 biovar El Tor str. N16961)
RXN-23221 [EC: 2.3.1.191]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191)" (EC 2.3.1.191)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (8/9 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (12/17 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (4/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (12/25 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Protein Sequence (351 amino acids)

>CSW01_11460 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Vibrio cholerae E7946 ATCC 55056)
MTTLTLAELATITGGELFGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVIM
VKTSERELCPSNALVVADPYVAFAKVAQALDSTPSPAHGIAPSAVIAEDAKLGHNVSIGA
NAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSDCLIQSGTVIGA
DGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNVIIDNQLQIAHN
VHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMGMVMRSIEEKGM
YSSGIPLQTNKEWRKTAARVHRIDDMHKRLKALEKLLEQSDTVQPDNSQAE