Protein Info for CSW01_11440 in Vibrio cholerae E7946 ATCC 55056

Annotation: ribonuclease HII

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF01351: RNase_HII" amino acids 22 to 196 (175 residues), 130.1 bits, see alignment E=5.2e-42

Best Hits

Swiss-Prot: 100% identical to RNH2_VIBC3: Ribonuclease HII (rnhB) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03470, ribonuclease HII [EC: 3.1.26.4] (inferred from 100% identity to vco:VC0395_A1837)

MetaCyc: 73% identical to RNase HII (Escherichia coli K-12 substr. MG1655)
Ribonuclease H. [EC: 3.1.26.4]

Predicted SEED Role

"Ribonuclease HII (EC 3.1.26.4)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA replication, archaeal or Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>CSW01_11440 ribonuclease HII (Vibrio cholerae E7946 ATCC 55056)
MAKKPSIELPPFEIPAGYALIAGVDEVGRGPLVGDVVTAAVILDPNRPIMGLNDSKKLSE
KKRLALFPEIQVKALAWAVGRCSPQEIDELNIFQATMVAMQRAVAGLRIQPDLVLIDGNK
IPKLPMEAQAVVKGDLRVAQISAASIIAKVIRDQEMEALDKQYPQFGFAKHKGYPTAAHF
AAIEQHGVIEQHRKSFGPVKRALGIE