Protein Info for CSW01_11340 in Vibrio cholerae E7946 ATCC 55056

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details PF02743: dCache_1" amino acids 74 to 310 (237 residues), 52.4 bits, see alignment E=5.4e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 353 to 510 (158 residues), 152.6 bits, see alignment E=4.1e-49 PF00990: GGDEF" amino acids 357 to 508 (152 residues), 145 bits, see alignment E=1.7e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VC2224)

Predicted SEED Role

"GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>CSW01_11340 GGDEF domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MVYGLRFTHYTRLLEQRMRFCFPLMEQKIEVSSTSRMLIMTRKKFSWILVTLIIFGFFVT
SLVSYKVAHDTLEEQINKDSLPLTSDNIYSEIQQDLIRPIFISSLMAQDTFVREWTLAGE
QDPERIIRYLREIQRQYQTISSFYISDRTGHYYHYTGILKQVSESNPNDAWFYRVKNSAP
DKNFEVNIDIDTANSQQTVVFVNYKVFDFENRFLGVIGVGLSSDAVSALVEKYQKRYNRH
IYFINELGEVTLHGSHHPGFDQIQQREGLKTLATQILTSPSVGASYYADGQKVYLNSRWV
DEFQWYIIVEQKDEFNHDIWFKATLGNLAISAFVALGVLGLAQMSFRGYQKRLEDMAVRD
KLTGAYNRQVFEELVDDAISLANKESHPLSLAVIDLDHFKQVNDNYGHPAGDLVLQRVVA
LCQRHIAQVGTLCRWGGEEFVVLLPHMTQQEAYQRMESIRAEIAMHASQPQVTVSIGVVQ
YQQNESLLHLFNRADQAMYTAKSEGRNKVVGL