Protein Info for CSW01_11295 in Vibrio cholerae E7946 ATCC 55056

Annotation: glutamate--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF00749: tRNA-synt_1c" amino acids 3 to 308 (306 residues), 387.8 bits, see alignment E=3.1e-120 TIGR00464: glutamate--tRNA ligase" amino acids 3 to 462 (460 residues), 642.5 bits, see alignment E=2.3e-197 PF19269: Anticodon_2" amino acids 323 to 464 (142 residues), 128.4 bits, see alignment E=2.7e-41

Best Hits

Swiss-Prot: 100% identical to SYE_VIBC3: Glutamate--tRNA ligase (gltX) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 100% identity to vch:VC2214)

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>CSW01_11295 glutamate--tRNA ligase (Vibrio cholerae E7946 ATCC 55056)
MTVKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEG
MTWLGLEWDEGPYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEANKEMPR
YDANHPKIKAVNDAAKEGEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDDLIIRRTDG
TPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAMILGDDGAK
LSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWGHGDQEIFSRDEMINLFSLNAISKSASA
FNTDKLLWLNNHYIKTSEPEYVAKHLEWHFENQGINKATGPALAEVVKLVGERCNTLVEL
AQQSRYFYEDFAEFDADAAKKHLRGVAKEPLMLALSKIEALTEWNTEALHHVIAQVCEEL
EIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALEYIETREANA