Protein Info for CSW01_11290 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13505: OMP_b-brl" amino acids 10 to 169 (160 residues), 69.1 bits, see alignment E=8.6e-23 PF01389: OmpA_membrane" amino acids 19 to 173 (155 residues), 163.6 bits, see alignment E=6.4e-52 PF00691: OmpA" amino acids 211 to 306 (96 residues), 94.6 bits, see alignment E=5.7e-31

Best Hits

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 100% identity to vch:VC2213)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>CSW01_11290 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MKKLAAIISATLLFASSAAVAEVYVGGKVGKSWLDDACLAGQSCEDDDQVVGAFLGYQAN
KWLSLEAGYDYLGKFTAAGLNDEKVQAVTLAPKLSIPLTEGIALYGKVGGAYVDYGSKDD
YSYLGAAGLEFNTNHNVTMRLEYQNLTDINNDIVRARAETATLGIAYKFGGSEEPAPVVE
QRPAEPAPVAAPVEKVAVTKTFTFQHLDSSTFATASAELKPATVQKLDKIVGYLNQYPQA
KVEVVGHTDSTGSEAYNQKLSERRAQAVAKALEAQGIDASRISAKGLGESSPIASNATAE
GREKNRRVELVIPEFQYQVTE