Protein Info for CSW01_11275 in Vibrio cholerae E7946 ATCC 55056

Annotation: NADPH-dependent ferric siderophore reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF08021: FAD_binding_9" amino acids 15 to 127 (113 residues), 119 bits, see alignment E=1.4e-38 PF04954: SIP" amino acids 134 to 253 (120 residues), 122.9 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 100% identical to VIUB_VIBC3: Vibriobactin utilization protein ViuB (viuB) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K07229, (no description) (inferred from 100% identity to vco:VC0395_A1802)

Predicted SEED Role

"Vibriobactin utilization protein ViuB" in subsystem Iron acquisition in Vibrio

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>CSW01_11275 NADPH-dependent ferric siderophore reductase (Vibrio cholerae E7946 ATCC 55056)
MSNEVERVYPRLLDFVRKKYVSKNLLRVTLTGEDLIGFPEDQNGSHIKVFFPNQASGILQ
LPIREGDKVIWPEHKPVPRAYTVRQYRAQSNELDIDFVVHGEGTPGGGWALKAQTGSQLG
LIGPGGPDPLIEPADWHIMAGDLSAVPAISAILEKMPSQAKGYVFLEVDDIEDKHDISHP
EQMVIKWLVRDPNQAQPVLAMAIEQLPVPQGAESLSAFVAGENESVIACRKILRNEYRIA
RDKIYAIPYWKRGKNEEAYHEERHVVMDEEF