Protein Info for CSW01_11230 in Vibrio cholerae E7946 ATCC 55056

Annotation: chemotaxis protein methyltransferase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF03705: CheR_N" amino acids 9 to 57 (49 residues), 43.2 bits, see alignment 6.3e-15 PF01739: CheR" amino acids 76 to 267 (192 residues), 200.3 bits, see alignment E=5.4e-63

Best Hits

Swiss-Prot: 100% identical to CHER1_VIBCH: Chemotaxis protein methyltransferase 1 (cheR1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 100% identity to vco:VC0395_A1793)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>CSW01_11230 chemotaxis protein methyltransferase 1 (Vibrio cholerae E7946 ATCC 55056)
MTAITISDQEYRDFCRFLESQCGIVLGDSKQYLVRSRLSPLVTKFKLSSLSDLLRDVVTG
RNRDLRVAAVDAMTTNETLWFRDSYPFTVLADKLLPEMAANKRPIKIWSAASSSGQEPYS
MAMTILEVQQKRPGLLPSVSITATDISASMLDMCRAGIYDNLALGRGLSPERRRVFFEDA
GDGRMKVKDNVKRLVNFRPQNLMESYSLLGKFDIIFCRNVLIYFSPDMKSKVLNQMAASL
NPGGYLLLGASESLTGLTDKFEMVRCNPGIIYKLK