Protein Info for CSW01_11225 in Vibrio cholerae E7946 ATCC 55056

Annotation: flagellar basal body rod protein FlgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR01396: flagellar basal-body rod protein FlgB" amino acids 5 to 128 (124 residues), 97.9 bits, see alignment E=2.8e-32

Best Hits

Swiss-Prot: 50% identical to FLGB_AERHH: Flagellar basal body rod protein FlgB (flgB) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K02387, flagellar basal-body rod protein FlgB (inferred from 100% identity to vcj:VCD_002138)

Predicted SEED Role

"Flagellar basal-body rod protein FlgB" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>CSW01_11225 flagellar basal body rod protein FlgB (Vibrio cholerae E7946 ATCC 55056)
MAISFDRALGIHQHTVGVRERNSEVIATNIAQANTPGFKAKGMDFQKALQAASSGASISL
SRTDSRHIPASSTMSGEILYRVPTQPDTGDGNTVDVDLERNLFMQNQIRHQASLDFLGSK
FKNLTKSLKGE