Protein Info for CSW01_11185 in Vibrio cholerae E7946 ATCC 55056

Annotation: flagellar assembly peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 11 to 306 (296 residues), 347.6 bits, see alignment E=4.3e-108 PF10135: Rod-binding" amino acids 53 to 102 (50 residues), 55.3 bits, see alignment 7.5e-19 PF01832: Glucosaminidase" amino acids 170 to 306 (137 residues), 120 bits, see alignment E=1e-38

Best Hits

Swiss-Prot: 100% identical to FLGJ_VIBCH: Peptidoglycan hydrolase FlgJ (flgJ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 100% identity to vch:VC2192)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>CSW01_11185 flagellar assembly peptidoglycan hydrolase FlgJ (Vibrio cholerae E7946 ATCC 55056)
MINNSNDIGFIQDIAGLDKLRQKAVNGDENAGQSALTAAARQFESIFTSMMLKSMRDANS
DFKSDLMSSQNEDLYRQMLDEQMASEFSSSGSLGLADMIVAQLSTGQTASEQKGEDGFQE
AMRRVEHARKTASERSNEDLVAAVYPLRKTQAVQSTQFDSRHSFVTKLKPYADKAARMLG
VDSSLLIAQAALETGWGQKMVKNARGNSNNLFNIKADRSWQGDKVATQTLEYHNNVPVVE
KAAFRSYASFDESFNDYVRFLENNPRYTNALDHGGNSERFIHGIHRAGYATDPQYADKVL
RVKAQIDQMNLL